Anthony Tristan | BlogArticles on .NET, AI/ML, data engineering, crypto, SEO, and building in public — by a 24-year software veteran.https://anthonytristan.info/en-usExtra! Extra! Extra! - Calling All Accredited Investors: A Brief Story About Finding Money For Your Businesshttps://anthonytristan.info/blog/2026-04-01-finding-money-for-your-business/https://anthonytristan.info/blog/2026-04-01-finding-money-for-your-business/The unfiltered story of funding CryptoQT™: crypto market crashes, accelerator rejections, and rigorous SBIR Phase I diligence — and why government validation matters for a startup.Thu, 02 Apr 2026 10:00:00 GMTfundingstartupssbirgrantsentrepreneurshipcryptoqtOrganoid Intelligence for Crypto Trading: CryptoQT™ + CorticalLabs Wetware Integrationhttps://anthonytristan.info/blog/2026-04-01-cryptoqt-cortical-labs-wetware-intelligence/https://anthonytristan.info/blog/2026-04-01-cryptoqt-cortical-labs-wetware-intelligence/How CryptoQT™ is exploring organoid intelligence via CorticalLabs: biological neural computing, neuromorphic anomaly detection, and SBIR-backed frontier science for crypto trading.Wed, 01 Apr 2026 12:00:00 GMTcryptoqtcortical-labswetwareorganoid-intelligencebiological-computingneuromorphic-computingspiking-neural-networkcrypto-tradinganomaly-detectionsbirquantitative-financebuilding-in-publicThe Science (and Fun) Behind CryptoQT™: How Behavioral Finance Meets AIhttps://anthonytristan.info/blog/2026-03-30-cryptoqt-science-of-behavioral-finance/https://anthonytristan.info/blog/2026-03-30-cryptoqt-science-of-behavioral-finance/How CryptoQT™ uses behavioral finance, AI, and real-time data to help you outsmart the crypto crowd. Explore the features that make trading smarter, safer, and more fun.Wed, 01 Apr 2026 10:30:00 GMTcryptoqtaibehavioral-financetradingquantitativemarket-psychologyproduct-featuresSetting up comments with Astro — a practical guide (with all the hiccups and fixes)https://anthonytristan.info/blog/2026-04-01-setting-up-comments-with-astro/https://anthonytristan.info/blog/2026-04-01-setting-up-comments-with-astro/How I built a moderated comments system with Astro + Supabase, why I made the security choices I did, and every hiccup we resolved along the way.Wed, 01 Apr 2026 10:30:00 GMTastrosupabasecommentssecuritytutorialBuilding a CSS-Only RSS Hover Drawer in Astro (No JavaScript Required)https://anthonytristan.info/blog/2026-04-02-rss-hover-drawer-astro/https://anthonytristan.info/blog/2026-04-02-rss-hover-drawer-astro/Build a CSS-only RSS hover drawer in Astro: a fixed slide-in panel listing your 5 latest posts with zero JavaScript — using getCollection at build time and a pure CSS transition.Wed, 01 Apr 2026 10:30:00 GMTastrorsscssstatic-siteweb-developmentuxcontent-collectionsseotutorialIntegrating TravelPayouts with Astro: Overcoming CSP and YAML Frontmatter Pitfallshttps://anthonytristan.info/blog/2026-03-31-integrating-travelpayouts-astro-csp-yaml/https://anthonytristan.info/blog/2026-03-31-integrating-travelpayouts-astro-csp-yaml/A practical guide to embedding TravelPayouts affiliate widgets in an Astro site, with solutions for Content Security Policy (CSP) and YAML formatting errors.Tue, 31 Mar 2026 10:00:00 GMTastrotravelpayoutscspyamlaffiliate-marketingtroubleshootingintegrationAstro Security Is Sooooooo Good, It Blocked ME From My Own Site!https://anthonytristan.info/blog/2026-03-30-astro-security-blocked-me/https://anthonytristan.info/blog/2026-03-30-astro-security-blocked-me/How Astro's static-first architecture, built-in CSP, and the Cloudflare acquisition create a security fortress that even your own AI tools can't get through.Mon, 30 Mar 2026 09:00:00 GMTastrosecurityweb-developmentcloudflarecspCryptoQT™: Building a Crypto Intelligence Platformhttps://anthonytristan.info/blog/2026-03-16-cryptoqt-building-crypto-intelligence/https://anthonytristan.info/blog/2026-03-16-cryptoqt-building-crypto-intelligence/How CryptoQT™ is built: detection architecture, behavioral finance philosophy, and hard-won lessons from shipping a crypto intelligence platform.Sun, 29 Mar 2026 15:30:00 GMTcryptoweb3machine-learningproduct-developmentsecuritybehavioral-financequantitative-tradingDEX Arbitrage: What It Actually Is, Why Most Bots Are Scams, and How CryptoQT™ Does It Righthttps://anthonytristan.info/blog/2026-03-16-dex-arbitrage/https://anthonytristan.info/blog/2026-03-16-dex-arbitrage/Legitimate DEX arbitrage vs. scam bots: how real on-chain arbitrage works, why most YouTube 'profit bots' drain wallets, and how CryptoQT™ does it right.Sun, 29 Mar 2026 14:30:00 GMTdex-arbitragemevcrypto-securitysmart-contractsblockchaincryptoqtbehavioral-financeSnipcart + Astro: From Test Mode to Live e-Commerce (No Rebuild Required)https://anthonytristan.info/blog/2026-03-28-snipcart-astro-integration-guide/https://anthonytristan.info/blog/2026-03-28-snipcart-astro-integration-guide/Add Snipcart to your Astro site: API key management, test/live mode switching, and webhook setup — no code changes needed between environments.Sat, 28 Mar 2026 12:00:00 GMTastrosnipcarte-commerceintegrationweb-developmentconfigurationwebhooksFire That Puppy Up: A Comedy of Miscommunication in AI Developmenthttps://anthonytristan.info/blog/2026-03-28-fire-that-puppy-up-ai-miscommunication/https://anthonytristan.info/blog/2026-03-28-fire-that-puppy-up-ai-miscommunication/The AI started the dev server instead of writing articles. A first-person account of context collapse, literal interpretation, and why clarity is everything in AI collaboration.Sat, 28 Mar 2026 11:00:00 GMTaidevelopmentcommunicationai-collaborationlessons-learnedhumorAstro & CSP: The Silent Security Vulnerability Hiding in Your Inline Event Handlershttps://anthonytristan.info/blog/2026-03-28-astro-csp-inline-handlers/https://anthonytristan.info/blog/2026-03-28-astro-csp-inline-handlers/Inline onclick and oninput handlers are CSP violations that expose your Astro site to XSS attacks. Learn why they're dangerous and how to fix them.Sat, 28 Mar 2026 10:00:00 GMTastrosecuritycspjavascriptbest-practicesxssweb-developmentAstro Content Collections: Why I'll Never Build a Blog Backend Againhttps://anthonytristan.info/blog/2026-03-28-astro-content-collections-game-changer/https://anthonytristan.info/blog/2026-03-28-astro-content-collections-game-changer/The moment I realized Astro's content collections feature eliminates the entire blog infrastructure problem. Type-safe, performant, scalable—and it's just markdown files.Sat, 28 Mar 2026 09:00:00 GMTastrocontent-collectionsstatic-site-generationdeveloper-experiencemarkdowntypescriptAI as an Exo-Suit: Human-AI Collaboration in Real-World Debugginghttps://anthonytristan.info/blog/2026-03-28-ai-exosuit-debugging-popup/https://anthonytristan.info/blog/2026-03-28-ai-exosuit-debugging-popup/How working with AI as a collaborative partner—not a replacement—helped us solve a tricky CSP-blocked popup component. A case study in modern development.Sat, 28 Mar 2026 08:00:00 GMTaiastrodebuggingcollaborationweb-developmentcsphuman-ai-collaborationYouWerks™ U-Coin: The Monetization Layer Behind XpertConnecthttps://anthonytristan.info/blog/2026-03-25-youwerks-ucoin-monetization-platform/https://anthonytristan.info/blog/2026-03-25-youwerks-ucoin-monetization-platform/How U-Coin and XpertConnect™'s incentive-aligned monetization layer creates a better home-services marketplace — better for homeowners, experts, and the platform.Wed, 25 Mar 2026 12:00:00 GMTxpertconnectucoinplatform-designmarketplacemonetizationbuilding-in-publicproduct-strategydotnetCryptoQT™: When Quantitative Trading Meets Behavioral Financehttps://anthonytristan.info/blog/2026-03-25-cryptoqt-behavioral-finance-update/https://anthonytristan.info/blog/2026-03-25-cryptoqt-behavioral-finance-update/CryptoQT™ build update: blending quantitative trading, market psychology, and adaptive AI — research notes without exposing proprietary signal design.Wed, 25 Mar 2026 11:00:00 GMTcryptoqtcryptoquantitative-tradingbehavioral-financepythonaimachine-learningbuilding-in-publicBuilding XpertConnect: AI-Guided Repair, Human-Powered Escalationhttps://anthonytristan.info/blog/2026-03-25-building-xpertconnect-dev-update-1/https://anthonytristan.info/blog/2026-03-25-building-xpertconnect-dev-update-1/XpertConnect build update: why I'm building it, how .NET architecture shapes the product, and closing the gap between generic DIY advice and expensive service calls.Wed, 25 Mar 2026 10:00:00 GMTxpertconnectbuilding-in-publicdotnetaidddhvacsoftware-architectureopenaiproduct-designBuilding XpertConnect — An AI-First DIY Guidance Platformhttps://anthonytristan.info/blog/2026-03-19-xpertconnect-ai-diy-guidance-platform/https://anthonytristan.info/blog/2026-03-19-xpertconnect-ai-diy-guidance-platform/Inside XpertConnect: an AI-powered DIY home repair platform with structured troubleshooting, safety escalation, and domain-driven .NET architecture — full build walkthrough.Thu, 19 Mar 2026 09:00:00 GMTbuilding-in-publicdotnetaidddhvacopenaipostgresqlarchitectureFrom Employee to Builder: Why Job Boards Are Broken (And What I Did Instead)https://anthonytristan.info/blog/2026-03-16-employee-to-builder/https://anthonytristan.info/blog/2026-03-16-employee-to-builder/Job boards collapsed. I got scammed, discriminated against, and ghosted. So I quit applying and started building my own products instead. Here's how.Mon, 16 Mar 2026 15:00:00 GMTjob-boardsentrepreneurshipindie-hackingcareer-pivotscamsbuilding-productsThe Hunt for a Ghost Error: Debugging Astro Content Collectionshttps://anthonytristan.info/blog/2026-03-16-debugging-astro-collection-errors/https://anthonytristan.info/blog/2026-03-16-debugging-astro-collection-errors/How I tracked down Astro's 'collection does not exist' error — TypeScript traps, wrong imports, and the fix hiding in plain sight.Mon, 16 Mar 2026 13:00:00 GMTastrodebuggingtypescriptcontent-collectionsweb-developmentBuilding Your First Data Pipeline Without Losing Your Mindhttps://anthonytristan.info/blog/2026-03-16-data-pipeline-guide/https://anthonytristan.info/blog/2026-03-16-data-pipeline-guide/A practical guide to designing resilient ETL pipelines that scale. Real-world lessons from building data systems for CryptoQt™ intelligence and XpertConnect™.Mon, 16 Mar 2026 12:00:00 GMTdata-engineeringetlsoftware-architecturedotnetdata-pipelinesdistributed-systemscryptoaiCrypto Scam Bots: The Anatomy of Modern Drainers and How to Avoid Themhttps://anthonytristan.info/blog/2026-03-16-crypto-scam-bots/https://anthonytristan.info/blog/2026-03-16-crypto-scam-bots/How wallet drainers and crypto scam bots work, the technical red flags that expose them, and how to protect yourself — based on real research building CryptoQT™.Mon, 16 Mar 2026 11:00:00 GMTcybersecuritycrypto-scamsblockchain-securitysmart-contractswallet-safetyfraud-detectionAI Is Eating Software Jobs — Here's What Engineers Should Do Right Nowhttps://anthonytristan.info/blog/2026-03-16-ai-eating-software-jobs/https://anthonytristan.info/blog/2026-03-16-ai-eating-software-jobs/How AI is reshaping software engineering jobs, which developer skills still matter, and a 24-year engineer's honest take on positioning yourself ahead of the shift.Mon, 16 Mar 2026 10:00:00 GMTaicareersoftware-engineeringjob-marketfuture-of-workartificial-intelligenceHow I Use AI to Build Faster Without Becoming Dependent on Ithttps://anthonytristan.info/blog/2026-03-16-ai-build-faster/https://anthonytristan.info/blog/2026-03-16-ai-build-faster/My actual AI development workflow: using GitHub Copilot and LLMs as a force multiplier without sacrificing code quality or architecture.Mon, 16 Mar 2026 09:00:00 GMTaiproductivitysoftware-developmentllmgithub-copilotdeveloper-tools24+ Years in .NET: What I Know Now That I Wish I Knew Thenhttps://anthonytristan.info/blog/2026-03-16-24-years-dotnet/https://anthonytristan.info/blog/2026-03-16-24-years-dotnet/Hard-won lessons from 24 years as a .NET developer: career pivots, architectural decisions that aged well, and what every C# engineer should know.Mon, 16 Mar 2026 08:00:00 GMTdotnetsoftware-engineeringcareercsharparchitectureOVHcloud Startup Program: What we Applied For and Whyhttps://anthonytristan.info/blog/2026-03-16-ovhcloud-startup-program-cryptoqt/https://anthonytristan.info/blog/2026-03-16-ovhcloud-startup-program-cryptoqt/Why CryptoQT™ applied to the OVHcloud Startup Program — EU cloud sovereignty, startup credits, and why it’s the right partner for a bootstrapped crypto intelligence platform.Thu, 12 Mar 2026 08:00:00 GMTovhcloudstartup-programcryptoqtcloudbuilding-in-publicWhy I Rebuilt My Website With Astro: Speed, SEO Power, and a Better Developer Experiencehttps://anthonytristan.info/blog/2026-03-16-why-i-chose-astro/https://anthonytristan.info/blog/2026-03-16-why-i-chose-astro/A deep dive into why I rebuilt anthonytristan.info using Astro — focusing on speed, SEO optimization, Snipcart integration, and a cleaner content workflow.Tue, 10 Mar 2026 08:00:00 GMTastroseoweb-developmentstatic-site-generatorsnipcartperformancebloggingAI Just Hired Me — A Guide to RentAHuman.ai for the New Gig Economyhttps://anthonytristan.info/blog/2026-03-16-ai-hiring-humans-rentahuman-guide/https://anthonytristan.info/blog/2026-03-16-ai-hiring-humans-rentahuman-guide/AI agents are now hiring real humans for real-world tasks. Here's how RentAHuman.ai works and how to earn income in the emerging AI-powered gig economy.Sun, 01 Mar 2026 08:00:00 GMTaigig-economyside-hustlerentahumanincomeai-agents